PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D05G2495
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 405aa    MW: 44004.2 Da    PI: 10.0677
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D05G2495genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_151.91.7e-16327374552
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                  +r+rr++kNRe+A rsR+RK+a++ eLe +v++L++eN++L+k+ +++
  Gh_D05G2495 327 RRQRRMIKNRESAARSRARKQAYTTELEAEVAKLKEENQELQKKHDHI 374
                  79****************************************998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.8E-15323388IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.381325374IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.06E-12327376No hitNo description
CDDcd147072.22E-24327371No hitNo description
Gene3DG3DSA:1.20.5.1701.8E-15327373No hitNo description
PfamPF001705.5E-14327376IPR004827Basic-leucine zipper domain
PROSITE patternPS000360330345IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 405 aa     Download sequence    Send to blast
MNFKNFGSNQ PPSDDGGGGN KPPGNYPISR QPSVYSLTFD EFQSTMGGIG TDFGSMNMDE  60
LLKSIWSAEE TQTMASPGVG LVGNGGLQRQ GSLTLPRTLS HKTVDEVWRE ISNEFSLGTE  120
ATDNMPQRQQ TLKEITLEEF LVRAGVVRED NTQFSGKDNN VNGGFFGELP QAGSNTSGFG  180
IGFQQGGRGP NLMGNRLPDG GNQNGIQASN LHMNLNGVRP NQHHLTRPQQ QPLCPKQPGV  240
EYGAQMGLQS GGQLGSPGIR CSQGLYNGLI HGGGMSMVGL RSPANHLSSD GIGKSSGDSS  300
SVSPVPYVFN GSLRGRKSSA VEKVAERRQR RMIKNRESAA RSRARKQAYT TELEAEVAKL  360
KEENQELQKK HDHIIKIQKN QVMEILNVQP GAKKRCLRRT RTGPW
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012447277.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5
SwissprotQ9M7Q41e-121AI5L5_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 5
TrEMBLA0A0D2UUY70.0A0A0D2UUY7_G
STRINGPOPTR_0002s12710.11e-143(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM73427129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G45249.12e-86abscisic acid responsive elements-binding factor 2